PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L00133.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family CAMTA
Protein Properties Length: 123aa    MW: 14687.7 Da    PI: 9.6427
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L00133.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1169.26.4e-53201222104
              CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptf 94 
                       l+ ++rwl++ ei++iL+n++k++++ e+++rp++gsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+e+n++f
  Migut.L00133.1.p  20 LEAQHRWLRPAEICEILQNYKKFRIAPEPPSRPPNGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENF 112
                       5669***************************************************************************************** PP

              CG-1  95 qrrcywlLee 104
                       qrr+yw+Lee
  Migut.L00133.1.p 113 QRRSYWMLEE 122
                       ********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143774.515122IPR005559CG-1 DNA-binding domain
SMARTSM010769.6E-6218122IPR005559CG-1 DNA-binding domain
PfamPF038591.0E-4521121IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 123 aa     Download sequence    Send to blast
MADSRRYALN AQLDIEQILL EAQHRWLRPA EICEILQNYK KFRIAPEPPS RPPNGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSIDVLH CYYAHGEDNE NFQRRSYWML  120
EE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012853297.11e-81PREDICTED: calmodulin-binding transcription activator 3
SwissprotQ6NPP44e-68CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLK4BSS54e-77K4BSS5_SOLLC; Uncharacterized protein
TrEMBLE5D5L15e-77E5D5L1_SOLLC; Calmodulin-binding protein
STRINGSolyc04g056270.2.11e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14489811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.23e-69Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains